forked from bebop/poly
-
Notifications
You must be signed in to change notification settings - Fork 0
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
Merge pull request bebop#394 from abondrn/ioToBio-genbank
multimap implemented
- Loading branch information
Showing
29 changed files
with
545 additions
and
122 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,147 @@ | ||
LOCUS NC_001141 439888 bp DNA linear CON 15-SEP-2023 | ||
DEFINITION Saccharomyces cerevisiae S288C chromosome IX, complete sequence. | ||
ACCESSION NC_001141 | ||
VERSION NC_001141.2 | ||
DBLINK BioProject: PRJNA128 | ||
Assembly: GCF_000146045.2 | ||
KEYWORDS RefSeq. | ||
SOURCE Saccharomyces cerevisiae S288C | ||
ORGANISM Saccharomyces cerevisiae S288C | ||
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; | ||
Saccharomycetes; Saccharomycetales; Saccharomycetaceae; | ||
Saccharomyces. | ||
REFERENCE 1 (bases 1 to 439888) | ||
AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., | ||
Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., | ||
Weng,S. and Cherry,J.M. | ||
TITLE New data and collaborations at the Saccharomyces Genome Database: | ||
updated reference genome, alleles, and the Alliance of Genome | ||
Resources | ||
JOURNAL Genetics 220 (4) (2022) | ||
PUBMED 34897464 | ||
REFERENCE 2 (bases 1 to 439888) | ||
AUTHORS Churcher,C., Bowman,S., Badcock,K., Bankier,A., Brown,D., | ||
Chillingworth,T., Connor,R., Devlin,K., Gentles,S., Hamlin,N., | ||
Harris,D., Horsnell,T., Hunt,S., Jagels,K., Jones,M., Lye,G., | ||
Moule,S., Odell,C., Pearson,D., Rajandream,M., Rice,P., Rowley,N., | ||
Skelton,J., Smith,V., Barrell,B. et al. | ||
TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome IX | ||
JOURNAL Nature 387 (6632 SUPPL), 84-87 (1997) | ||
PUBMED 9169870 | ||
REFERENCE 3 (bases 1 to 439888) | ||
AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., | ||
Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., | ||
Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and | ||
Oliver,S.G. | ||
TITLE Life with 6000 genes | ||
JOURNAL Science 274 (5287), 546 (1996) | ||
PUBMED 8849441 | ||
REFERENCE 4 (bases 1 to 439888) | ||
CONSRTM NCBI Genome Project | ||
TITLE Direct Submission | ||
JOURNAL Submitted (14-SEP-2023) National Center for Biotechnology | ||
Information, NIH, Bethesda, MD 20894, USA | ||
REFERENCE 5 (bases 1 to 439888) | ||
CONSRTM Saccharomyces Genome Database | ||
TITLE Direct Submission | ||
JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford | ||
University, Stanford, CA 94305-5120, USA | ||
REMARK Protein update by submitter | ||
REFERENCE 6 (bases 1 to 439888) | ||
CONSRTM Saccharomyces Genome Database | ||
TITLE Direct Submission | ||
JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford | ||
University, Stanford, CA 94305-5120, USA | ||
REMARK Sequence update by submitter | ||
REFERENCE 7 (bases 1 to 439888) | ||
CONSRTM Saccharomyces Genome Database | ||
TITLE Direct Submission | ||
JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford | ||
University, Stanford, CA 94305-5120, USA | ||
COMMENT REVIEWED REFSEQ: This record has been curated by SGD. The reference | ||
sequence is identical to BK006942. | ||
|
||
On Apr 26, 2011 this sequence version replaced NC_001141.1. | ||
|
||
##Genome-Annotation-Data-START## | ||
Annotation Provider :: SGD | ||
Annotation Status :: Full Annotation | ||
Annotation Version :: R64-4-1 | ||
URL :: http://www.yeastgenome.org/ | ||
##Genome-Annotation-Data-END## | ||
COMPLETENESS: full length. | ||
FEATURES Location/Qualifiers | ||
source 1..439888 | ||
/organism="Saccharomyces cerevisiae S288C" | ||
/mol_type="genomic DNA" | ||
/strain="S288C" | ||
/db_xref="taxon:559292" | ||
/chromosome="IX" | ||
telomere complement(1..7784) | ||
/note="TEL09L; Telomeric region on the left arm of | ||
Chromosome IX; composed of an X element core sequence, X | ||
element combinatorial repeats, a long Y' element, and a | ||
short terminal stretch of telomeric repeats" | ||
/db_xref="SGD:S000028896" | ||
gene complement(<483..>6147) | ||
/locus_tag="YIL177C" | ||
/db_xref="GeneID:854630" | ||
mRNA complement(join(<483..4598,4987..>6147)) | ||
/locus_tag="YIL177C" | ||
/product="Y' element ATP-dependent helicase" | ||
/transcript_id="NM_001179522.1" | ||
/db_xref="GeneID:854630" | ||
CDS complement(join(483..4598,4987..6147)) | ||
/locus_tag="YIL177C" | ||
/EC_number="3.6.4.12" | ||
/note="Putative Y' element ATP-dependent helicase" | ||
/codon_start=1 | ||
/product="Y' element ATP-dependent helicase" | ||
/protein_id="NP_012092.1" | ||
/db_xref="GeneID:854630" | ||
/db_xref="SGD:S000001439" | ||
/translation="MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVR | ||
SFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPI | ||
PSKYLIPKKINLMVYTLFQVHTLKFNRKDYDTLSLFYLNRGYYNELSFRVLERCHEIA | ||
SARPNDSSTMRTFTDFVSGAPIVRSLQKSTIRKYGYNLAPYMFLLLHVDELSIFSAYQ | ||
ASLPGEKKVDTERLKRDLCPRKPIEIKYFSQICNDMMNKKDRLGDILHIILRACALNF | ||
GAGPRGGAGDEEDRSITNEEPIIPSVDEHGLKVCKLRSPNTPRRLRKTLDAVKALLVS | ||
SCACTARDLDIFDDNNGVAMWKWIKILYHEVAQETTLKDSYRITLVPSSDGISLLAFA | ||
GPQRNVYVDDTTRRIQLYTDYNKNGSSEPRLKTLDGLTSDYVFYFVTVLRQMQICALG | ||
NSYDAFNHDPWMDVVGFEDPNQVTNRDISRIVLYSYMFLNTAKGCLVEYATFRQYMRE | ||
LPKNAPQKLNFREMRQGLIALGRHCVGSRFETDLYESATSELMANHSVQTGRNIYGVD | ||
SFSLTSVSGTTATLLQERASERWIQWLGLESDYHCSFSSTRNAEDVVAGEAASSNHHQ | ||
KISRVTRKRPREPKSTNDILVAGQKLFGSSFEFRDLHQLRLCYEIYMADTPSVAVQAP | ||
PGYGKTELFHLPLIALASKGDVEYVSFLFVPYTVLLANCMIRLGRCGCLNVAPVRNFI | ||
EEGYDGVTDLYVGIYDDLASTNFTDRIAAWENIVECTFRTNNVKLGYLIVDEFHNFET | ||
EVYRQSQFGGITNLDFDAFEKAIFLSGTAPEAVADAALQRIGLTGLAKKSMDINELKR | ||
SEDLSRGLSSYPTRMFNLIKEKSEVPLGHVHKIRKKVESQPEEALKLLLALFESEPES | ||
KAIVVASTTNEVEELACSWRKYFRVVWIHGKLGAAEKVSRTKEFVTDGSMQVLIGTKL | ||
VTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKGELPP | ||
IKEGCITEQVREFYGLESKKGKKGQHVGCCGSRTDLSADTVELIERMDRLAEKQATAS | ||
MSIVALPSSFQESNSSDRYRKYCSSDEDSNTCIHGSANASTNASTNAITTASTNVRTN | ||
ATTNASTNATTNASTNASTNATTNASTNATTNSSTNATTTASTNVRTSATTTASINVR | ||
TSATTTESTNSSTNATTTESTNSSTNATTTESTNSNTSATTTASINVRTSATTTESTN | ||
SSTSATTTASINVRTSATTTKSINSSTNATTTESTNSNTNATTTESTNSSTNATTTES | ||
TNSSTNATTTESTNSNTSAATTESTNSNTSATTTESTNASAKEDANKDGNAEDNRFHP | ||
VTDINKESYKRKGSQMVLLERKKLKAQFPNTSENMNVLQFLGFRSDEIKHLFLYGIDI | ||
YFCPEGVFTQYGLCKGCQKMFELCVCWAGQKVSYRRIAWEALAVERMLRNDEEYKEYL | ||
EDIEPYHGDPVGYLKYFSVKRREIYSQIQRNYAWYLAITRRRETISVLDSTRGKQGSQ | ||
VFRMSGRQIKELYFKVWSNLRESKTEVLQYFLNWDEKKCQEEWEAKDDTVVVEALEKG | ||
GVFQRLRSMTSAGLQGPQYVKLQFSRHHRQLRSRYELSLGMHLRDQIALGVTPSKVPH | ||
WTAFLSMLIGLFYNKTFRQKLEYLLEQISEVWLLPHWLDLANVEVLAADDTRVPLYML | ||
MVAVHKELDSDDVPDGRFDILLCRDSSREVGE" | ||
rep_origin 7470..8793 | ||
/note="ARS902; Putative replication origin; identified in | ||
multiple array studies, not yet confirmed by plasmid-based | ||
assay" | ||
/db_xref="SGD:S000130156" | ||
mRNA join(<155222,155311..>155765) | ||
/gene="COX5B" | ||
/locus_tag="YIL111W" | ||
/product="cytochrome c oxidase subunit Vb" | ||
/transcript_id="NM_001179459.1" | ||
/db_xref="GeneID:854695" | ||
CONTIG join(BK006942.2:1..439888) | ||
// | ||
|
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
File renamed without changes.
Oops, something went wrong.